PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009602461.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 282aa    MW: 32428.2 Da    PI: 6.7977
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009602461.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.73.7e-103075346
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                     +WTteE +++ da +++ ++   +W  +a++++ g+t ++++  ++ 
   XP_009602461.1 30 KWTTEENKRFEDALALFDKEtpdRWYNVAAMIP-GKTVNDVIKQYRE 75
                     8*****************99*************.********99986 PP

2Myb_DNA-binding46.96.4e-15143187347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+++++ + k++G+g+W+ I+r   ++Rt+ q+ s+ qky
   XP_009602461.1 143 PWTEEEHKQFLLGLKKYGKGDWRNISRNYVTTRTPTQVASHAQKY 187
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.5582681IPR017884SANT domain
Gene3DG3DSA:1.10.10.608.8E-42677IPR009057Homeodomain-like
SMARTSM007172.8E-92779IPR001005SANT/Myb domain
PfamPF002493.6E-82976IPR001005SANT/Myb domain
SuperFamilySSF466891.51E-112983IPR009057Homeodomain-like
CDDcd001676.11E-73077No hitNo description
Gene3DG3DSA:1.10.10.603.0E-12134192IPR009057Homeodomain-like
PROSITE profilePS5129420.579136192IPR017930Myb domain
SuperFamilySSF466892.94E-17138191IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-17139191IPR006447Myb domain, plants
SMARTSM007178.1E-13140190IPR001005SANT/Myb domain
CDDcd001671.37E-10143188No hitNo description
PfamPF002491.7E-12143187IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MSSEMRFLCP ATTYLRNSNW LFEENKGTTK WTTEENKRFE DALALFDKET PDRWYNVAAM  60
IPGKTVNDVI KQYRELVEDI SDIEAGLIPI PGYTTCTNSF TLEWINHDQE GDFHDLNKRF  120
CGPSGKRNTS TRPSEHERKK GVPWTEEEHK QFLLGLKKYG KGDWRNISRN YVTTRTPTQV  180
ASHAQKYFIR QLSGGKDKRR SSIHDITTVN ITEMTSPSPE NHTSSISQDK SAPSPQEQGL  240
YEYDLPNQEA DIAFKTFGLK LHESGMHSFI LQGLQFGQYN AM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A4e-1831961176RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009602461.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_016440424.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H74e-99DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLM1BNE71e-166M1BNE7_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000492091e-166(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45824140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.11e-108MYB family protein